PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c15_1270V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 623aa    MW: 68924.1 Da    PI: 7.7678
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c15_1270V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-181461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEd++lv++++q+G g+W+++++  g+ R++k+c++rw +yl
  Pp3c15_1270V3.1.p 14 KGLWSPEEDDKLVRYITQHGHGCWSAVPKQAGLQRCGKSCRLRWINYL 61
                       678*******************************************97 PP

2Myb_DNA-binding431.1e-1367110146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg +++ E+ l++d ++ lG++ W+ Ia  ++ gRt++++k++w++
  Pp3c15_1270V3.1.p  67 RGVFSATEESLIIDWHAALGNR-WSQIATQLP-GRTDNEIKNFWNS 110
                        899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-26664IPR009057Homeodomain-like
PROSITE profilePS5129424.666965IPR017930Myb domain
SuperFamilySSF466892.33E-2711108IPR009057Homeodomain-like
SMARTSM007171.7E-131363IPR001005SANT/Myb domain
PfamPF002491.0E-151461IPR001005SANT/Myb domain
CDDcd001671.65E-111761No hitNo description
Gene3DG3DSA:1.10.10.606.5E-2365116IPR009057Homeodomain-like
PROSITE profilePS5129417.82966116IPR017930Myb domain
SMARTSM007171.9E-1266114IPR001005SANT/Myb domain
PfamPF002495.3E-1267110IPR001005SANT/Myb domain
CDDcd001672.97E-870109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
MGRHSCCHKQ KLKKGLWSPE EDDKLVRYIT QHGHGCWSAV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGVF SATEESLIID WHAALGNRWS QIATQLPGRT DNEIKNFWNS CIKKKLRSMG  120
IDPSTHKFVT PNPTLMEAGE SSSSEINPTN NSHKSSTQLM AGGIDRAGEG NVRLRNKFKA  180
QSTFLVPQTA QNIFNSSEDV MYNPTRSLIH RVSSQYSHAV GHLVDFNRVD LQAGHTPSMK  240
LSTDNLLERL MVSGTSNDAG FSPTAPNLAE SSPNHLQPES YDSARLVEVE QQSTTIPPVF  300
NPVYWLLGQS GAATSSSSAS VQVHLTCKGN KVHDRGTQQL DPQLSSFSDS PQYLSEMEPR  360
LGPRSTHSDS SSLSPNPDFI PGGKFPGHAS FVQDRGELSS ITANLHQPGD TLQLGCRSGN  420
DIYMSADLEH PERGLRRPYF WPEPNSCSTS NLSIEINHQT NRNHRALSPL GTNHLWQNRA  480
GTDIPAISTV KRKCASVLPA KDVISDQHFS AKRATLICSP DDLLKRGAAN PDCDVVMKLC  540
DLQDQQQTCH NVHDRTRINT VGLDQVNHQL LAVTGPEVYV DNDPWQIVQT QDGAQGHSSF  600
YHAPMVPIFR DLQRMAAVLD QI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26121165108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S211_139V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.34e-78myb domain protein 55